PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g028480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 312aa    MW: 35593.9 Da    PI: 6.5118
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g028480.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.8e-082612942154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp+++++++L +++gL+ +q+ +WF N+R +
  Sopen08g028480.1 261 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 294
                       469*****************************87 PP

2ELK26.31.8e-09215236122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK +L++++++++ ++++E++
  Sopen08g028480.1 215 ELKIELKQGFRSRIEDVREEIL 236
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.7E-194387IPR005540KNOX1
PfamPF037904.5E-174586IPR005540KNOX1
SMARTSM012566.8E-25104159IPR005541KNOX2
PfamPF037913.2E-18108158IPR005541KNOX2
PROSITE profilePS512139.184215235IPR005539ELK domain
PROSITE profilePS5007111.677235298IPR001356Homeobox domain
SuperFamilySSF466894.28E-16237302IPR009057Homeodomain-like
SMARTSM003891.4E-10237302IPR001356Homeobox domain
CDDcd000861.84E-11238299No hitNo description
Gene3DG3DSA:1.10.10.607.5E-25242300IPR009057Homeodomain-like
PfamPF059201.1E-17255294IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MQQEEGGLGL MGSSNTSGLG GGDISSMMIS SEDHHNRNLN HYNQLKSEIA THPLYEQLLS  60
AHVACLRVAT PIDQLPLIDA QLTQSHNLLR SYASSQQQQQ QQQHSLSHHE RQELDNFLAQ  120
YLLVLCSFKE QLQQHVRVHA VEAVMACREI EQNLQLLTGA TLGEGTGATM SDDEDELQMD  180
FSLDVSGSDA HDLMGMGFGL PTESERSLME RVRQELKIEL KQGFRSRIED VREEILRKRR  240
AGKLPGDTTT VLKNWWQQHS KWPYPTEDDK AKLVEETGLQ LKQINNWFIN QRKRNWHSNS  300
QSVTSLKSKR KR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12238294864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1291311RKRNWHSNSQSVTSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLEU764100.0U76410.1 Lycopersicon esculentum homeobox 2 protein (THox2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083215.10.0PREDICTED: homeobox protein HD1
SwissprotQ9FPQ81e-165KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLK4CP120.0K4CP12_SOLLC; Uncharacterized protein
STRINGSolyc08g080120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67732329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-148KNOTTED-like homeobox of Arabidopsis thaliana 7